Total number of results for Cancer pagurus are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00683 |
RSAQGMGKMERLLASYRGALEPSTPLGDLSGSLGHPVE
|
38 | Cancer pagurus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 9809792#Chung J.S., Wilkinson M.C., Webster S.G.; #Amino acid sequences of both isoforms of crustacean hyperglycemic hormone (CHH) and corresponding precursor-related peptide in Cancer pagurus.; #Regul. Pept. 77:17-24(1998). |